Please use this identifier to cite or link to this item: https://doi.org/10.1016/j.bios.2012.02.042
Title: Functional protease assay using liquid crystals as a signal reporter
Authors: Chen, C.-H. 
Yang, K.-L. 
Keywords: α-Chymotrypsin
Liquid crystals
Oligopeptide
Protease assay
Issue Date: 15-May-2012
Source: Chen, C.-H., Yang, K.-L. (2012-05-15). Functional protease assay using liquid crystals as a signal reporter. Biosensors and Bioelectronics 35 (1) : 174-179. ScholarBank@NUS Repository. https://doi.org/10.1016/j.bios.2012.02.042
Abstract: We report a functional protease assay in which liquid crystals (LCs) are used as signal reporters to transduce the test results into optical signals. In this assay, an oligopeptide substrate (CLSELDDRADALQAGASQFESSAAKLKRKYWWKNLK) is used as a probe. This oligopeptide can be cleaved by α-chymotrypsin at multiple locations and become smaller fragments after the cleavage. When the original oligopeptide is immobilized on a solid surface, its long flexible oligopeptide chain is able to influence the orientation of a thin layer of LC supported on the surface, as is evident as a bright spot on the surface. In contrast, when the shorter oligopeptide fragments are immobilized on the same surface, their shorter, less flexible chains cannot disrupt the orientation of LC, and a dark spot is observed. On the basis of the dark or bright signal from LC, α-chymotrypsin in buffer solution or complex media such as chicken broth can be detected by using the naked eye. However, when the incubation time is 3. h, the limit of detection (LOD) for α-chymotrypsin in buffer solution is 50. ng/mL, whereas that in chicken broth is only 500. ng/mL. Unlike traditional antibody-based assays which show little difference between active and inactive α-chymotrypsin, only active protease can be detected in this assay. This study shows the potential utility of LCs for detecting functional proteases with good specificity and sensitivity. © 2012 Elsevier B.V.
Source Title: Biosensors and Bioelectronics
URI: http://scholarbank.nus.edu.sg/handle/10635/63958
ISSN: 09565663
DOI: 10.1016/j.bios.2012.02.042
Appears in Collections:Staff Publications

Show full item record
Files in This Item:
There are no files associated with this item.

SCOPUSTM   
Citations

7
checked on Dec 7, 2017

WEB OF SCIENCETM
Citations

7
checked on Nov 22, 2017

Page view(s)

25
checked on Dec 11, 2017

Google ScholarTM

Check

Altmetric


Items in DSpace are protected by copyright, with all rights reserved, unless otherwise indicated.